SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000015949 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000015949
Domain Number 1 Region: 357-763
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-90
Family ALDH-like 0.000000122
Further Details:      
 
Domain Number 2 Region: 71-347
Classification Level Classification E-value
Superfamily Carbamate kinase-like 3.8e-33
Family PyrH-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000015949   Gene: ENSNLEG00000013150   Transcript: ENSNLET00000016764
Sequence length 789
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:29089584:29140368:-1 gene:ENSNLEG00000013150 transcript:ENSNLET00000016764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVYRCGFQPFNQHLLPWVQCTIVSRSHRIQPSVIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQVRGWSLKGVQTTGIWCQLHHLLLEKSEESFLSNLFVPQFPYLKMGIISVISVKD
NDSLAARLAVEMKLISDVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSRVGMG
GMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQ
GEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRL
SLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDC
LPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEVEDLC
RLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKC
EYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRT
EYGDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTENENTAEFFLQHVDSACVFWNASTR
FSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHEN
LPIPQRNTN
Download sequence
Identical sequences ENSNLEP00000015949 ENSNLEP00000015949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]