SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016061 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016061
Domain Number 1 Region: 145-232,296-517,644-671
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.61e-28
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 
Domain Number 2 Region: 26-184
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000471
Family NHL repeat 0.029
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016061
Domain Number - Region: 926-1014
Classification Level Classification E-value
Superfamily Prefoldin 0.000837
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016061   Gene: ENSNLEG00000013251   Transcript: ENSNLET00000016881
Sequence length 1250
Comment pep:known_by_projection supercontig:Nleu1.0:GL397442.1:45421:129771:1 gene:ENSNLEG00000013251 transcript:ENSNLET00000016881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVVAQTLHVFGLRSHVANNIFYFDEQIIVFPSGNHCVKYNVDQKWQKFIPGSDKSQGM
LALSISPNRRYLAISETVQEKPAITIYELSSIPCRKRKVLNNFDFQVQKFISMAFSPDSK
YLLAQTSPPESNLVYWLWEKQKVMAIVRIDTQNNPVYQVSFSPQDNTQVCVTGSGMFKLL
RFAEGTLKQTNFHRGEPQNYLAHTWVADDKIVVGTDTGKLFLFESGDQRWETSIKVKEPT
DGSKSLDVIQESESLIEFPPVSSPLPSYEQMVAASSHSQMSMPQVFAIAAYSKGFACSAG
PGRVLLFEKMEEKDLYRESREIRIPVDPQSNDPSQSDKQDILCLCFSPSEETLVASTSKN
QLYSITMSLTEISKGEPAHFEYLMYPLHSAPITGLATCIRKPLIATCSLDRSIRLWNYET
NTLELFKEYQEEAYSISLHPSGHFIVVGFADKLRLMNLLIDDIRSFKEYSVRGCRECSFS
NGGHLFAAVNGNVIHVYTTTSLENISNLKGHTGKVSAWTWDTGEQKRGGSFPHGSLPEMG
DSWGVRGRESLWARNGRNGKEAIVDIYTIDNSGGDTVREKWMDSNDFRKITWAQEVKAAI
SHDHTTALQPRGRGIGRVRRLLSHSYLGSSLPPYEALAQPWSSMLLTFDDQFLLTAAEDG
CLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQVMLELKTRVEELKMENEYQLR
LKDINYSEKIKELTDKFIQEMESLKTKNQVLRTEKEKQDVYHREHIEDLLDKQSRELQDL
ECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTT
LLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYEKKLRDEKESNLRLKGETGIMR
KKFSSLQKEIEERTNDIETLKGEQMKLQGVIKSLEKDIQGLKREIQERDETIQDKEKRIY
DLKKKNQELGKFKFVLDYKIKELKKQIEPRENEIRVMKEQIQEMEAELENFRKQNTQLEL
NITELWQKLRATDQEMLRERQKERDLEALVKRFKTDLHNCVAYIQEPRLLKEKVRGLFEK
YVQRADMVEIAGLNTDLQQEYTRQREHLERNLATLKKKVVKEGELHRTDYIRIMQENVSL
IKEINELRRELKFTRSQVYDLEAALKLTKKVQPQEVSETEPSRDVLSTAPTARLNEQEET
GRIIEMQRLEIQRLRDQIQEQEQVTGFHALAGVRLPSLSNSEVDLEVKTN
Download sequence
Identical sequences ENSNLEP00000016061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]