SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016102 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016102
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 6.41e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000176
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.31e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000131
Further Details:      
 
Domain Number 3 Region: 248-283
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000941
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016102   Gene: ENSNLEG00000013299   Transcript: ENSNLET00000016924
Sequence length 285
Comment pep:known_by_projection supercontig:Nleu1.0:GL397578.1:43192:49405:1 gene:ENSNLEG00000013299 transcript:ENSNLET00000016924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPSGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQRRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGCS
Download sequence
Identical sequences ENSNLEP00000016102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]