SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016285 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016285
Domain Number 1 Region: 318-477
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.47e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000181
Further Details:      
 
Domain Number 2 Region: 156-316
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.76e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00004
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000982
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 76-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000175
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 24-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016285   Gene: ENSNLEG00000013418   Transcript: ENSNLET00000017118
Sequence length 480
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:16473981:16933079:-1 gene:ENSNLEG00000013418 transcript:ENSNLET00000017118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADDSFSCECPDGFTDPNCS
SVVEVASDEEEPTSAGPCIPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI
NECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTH
RALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSP
EYIKSYKIAYSNDGKTWAMYKVKGTNEDVVFRGNIDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDK
QGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Download sequence
Identical sequences G1RSR1
ENSNLEP00000016285 ENSNLEP00000016285 XP_003261619.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]