SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016352 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016352
Domain Number 1 Region: 172-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 2 Region: 262-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000967
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 218-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 4 Region: 116-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000948
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016352
Domain Number - Region: 607-804
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00439
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016352   Gene: ENSNLEG00000013491   Transcript: ENSNLET00000017191
Sequence length 893
Comment pep:known_by_projection supercontig:Nleu1.0:GL397381.1:5553309:5587624:1 gene:ENSNLEG00000013491 transcript:ENSNLET00000017191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLCTASSGEGPGPAAVRTPSFIKSWPRDSLHNCPACGGGTALSHSLFPLPLLPAARTM
GGRVFLAFCIWLTLPGAETQDSRGCAPWCPQNSSCVNATACRCNPGFSSFSEIITTPTET
CDDINECASPSKVSCGKFADCKNSEGSYHCMCSPGYELASGAKTFKNESENTCQDVDECQ
QNPRLCKSYGTCVNTLGSYTCQCLPGFKIKPEDPKLCTDVNECTSGQNPCHSSTHCLNNV
GSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDNSTVCFNTLGSYSCRCRPGW
KPKHGIPNKQKDTVCEEMTFPTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAKVTIQNV
IKLVDELMEAPGDIEALAPPVRHLIATQLLSILEDVMRILAKNLPEGPFTYVSPSDTELT
LMIQERGDKNVTMGQSNARMKLNWAVAAGAEEPGPAVAGILSIRNMTTLLANASLNLHSK
KQAELEEIYESNIRGVRLRRLSAVNSVLLCALFTAVSPNLLHSVGAQVSSRPTFLTTPIC
PQDVMPGPRQELLCAFWKSDSNRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYD
VEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGI
ENEGGQVGLRCRLVAGLLHYCFLASFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYG
VPLLIVGVSAAVYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQK
FSEINPDMKKLKKARKRQLQWAKMAPLHSSLGGWGKRITCAQEFKVAVNYDGACMVPGPA
PALTWCLGQQVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI
Download sequence
Identical sequences ENSNLEP00000016352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]