SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016448 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016448
Domain Number 1 Region: 377-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000581
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 257-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 3 Region: 161-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000565
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 495-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000509
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016448   Gene: ENSNLEG00000013356   Transcript: ENSNLET00000017292
Sequence length 681
Comment pep:known_by_projection supercontig:Nleu1.0:GL397532.1:503240:585509:1 gene:ENSNLEG00000013356 transcript:ENSNLET00000017292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCAVDADVLLEACCADGHRMATHQKDCSLPYATESKECRMVQEQCCHSQLEELHCATGI
SLANEQDHCATPHGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRA
CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCF
VGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKD
IDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPVG
HTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRC
ECKTGYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYLCSCSVGFRLSVDGRSCEDI
NECSSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIP
GSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLAFECPENYRR
SAATLQQEKTDTVRCIKSCRPNDVTCVFDPVHTISHTVISLPTFREFTRPEEIIFLRAIT
PPHPASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMNYVV
GGVVSHRNVVNVHIFVSEYWF
Download sequence
Identical sequences ENSNLEP00000016448 ENSNLEP00000016448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]