SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016683 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016683
Domain Number 1 Region: 996-1288
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-64
Family Protein kinases, catalytic subunit 0.0000407
Further Details:      
 
Domain Number 2 Region: 132-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000223
Family N-terminal PAS domain of Pas kinase 0.000005
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016683
Domain Number - Region: 347-389
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00401
Family Heme-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016683   Gene: ENSNLEG00000013731   Transcript: ENSNLET00000017533
Sequence length 1329
Comment pep:known_by_projection supercontig:Nleu1.0:GL397447.1:2013683:2052249:-1 gene:ENSNLEG00000013731 transcript:ENSNLET00000017533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGGLTAFEEDQRCLSQSLPLPVPAEGPAAQTTAEPSRSFSSAQRHLSRRNGLSRLCQS
RTALSEDRWSSYCLSSLAAQNICTSQLHCPAAPEHTDPSGPRGSVSCCSLLRGLSSGWSS
PLLPAPVCNPNKAIFTVDAKTTEILVANDKACRLLGYSSQDLIGQKLTQFFLRSDSDVVE
ALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQEHRLCCVVVLEPVERVST
WVAFQSDVSVQLCLXXXXHLHGYVSGEDVAEQHITDLIPSVQLPPPGQHIPKNLKIQRSV
GRARDGTTFPLSLKLKSQPSSEEVTTGEAAPARGYQASVWVFCTISGLITLLPDGTIHGI
NHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYDSSLQLPDLASCLDVGDESGCGER
TLDPWQGQDPAEGAQDPRINVVLAGGHIVPRDETRKLVESQDIFTGTQTELGAGGQLLSR
LSPQPAPGVDSVPEGSLPVHGEQVLPEDQQVTALGREEPVAIESPRQGLLGESRSEPVDV
KPFASCKESEARVPAEDGGSDAGMCGLCQKAQLERMGVSGPSSSDLWAGAAVAEPQAKGQ
LAGGSLLMHCPCYGSEWGLWRSQDLAPSPSGMXXXXXXXXXLDEPWLGVKNDREELQTCL
IKEQLSQLSLAGALDVPHAELVPTECPAVTAPVSSCDLGGRDLYSGCTGSSSACYALATD
LPGALEAVEAQEVDVNSFSWNLKEPFFSDQTDQTSSNCSCATSELRGTPSSLAVGSDPDV
GSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRDSCLGQDPTEPLEVCLVSSEHYAASDR
ESPGRVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMCGAAGLQREIQEGAYSGSCYHR
DGLRLSIQFEVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPSSTHSTAAEL
TGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTLSPLGSGAFGFVWTAVDKEK
NKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDVFENQGFFQLVM
EKHGSGLDLFAFIDRHPRLDEPLASYIFRQVRAGQSRLVSAVGYLRLKDIIHRDIKDENI
VIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLY
TLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPEKRTTLEKLVTDPWVTQP
VNLADYTWEEVCRVNKPESGVLSTASLEMGNRSLSEVAQAQELCGGPVPGEAPNSQGCLH
PGDPRLLTS
Download sequence
Identical sequences ENSNLEP00000016683 ENSNLEP00000016683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]