SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016696 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016696
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016696   Gene: ENSNLEG00000013761   Transcript: ENSNLET00000017547
Sequence length 306
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:22940346:22956035:-1 gene:ENSNLEG00000013761 transcript:ENSNLET00000017547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVQSSGQVYAFANCSDSDMLEEDAEVYELRSRGKEKVRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LCPPKGRQTSRHSSVQYSSEQQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRE
NLNEVVSALTAQQIRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSP
AAQHET
Download sequence
Identical sequences G1RTX2
ENSNLEP00000016696 XP_003261651.1.23891 ENSNLEP00000016696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]