SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016712 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016712
Domain Number 1 Region: 85-164
Classification Level Classification E-value
Superfamily DNA-binding domain 5.56e-25
Family Methyl-CpG-binding domain, MBD 0.00000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016712   Gene: ENSNLEG00000013783   Transcript: ENSNLET00000017563
Sequence length 164
Comment pep:known_by_projection supercontig:Nleu1.0:GL397458.1:647837:714893:-1 gene:ENSNLEG00000013783 transcript:ENSNLET00000017563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAPSGGGGGGEEERLEEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQP
SAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKL
KQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDP
Download sequence
Identical sequences ENSNLEP00000016712 ENSNLEP00000016712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]