SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000016813 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000016813
Domain Number 1 Region: 1-104,152-238
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000439
Family DNA gyrase/MutL, N-terminal domain 0.057
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000016813
Domain Number - Region: 696-731
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.011
Family RILP dimerisation region 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000016813   Gene: ENSNLEG00000013844   Transcript: ENSNLET00000017665
Sequence length 858
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:3110489:3162343:-1 gene:ENSNLEG00000013844 transcript:ENSNLET00000017665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNAVDPDVSARTVFIDVEEVKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPI
GVFGNGFKSGSMRLGKDALVFTKNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNNFL
EMENDSLPSLEAILNYSIFNRENDLLAQFDAIPGKKGTRVLIWNIRRNKNGKSELDFDTD
QYDILVSDFDTEEKMTGGVTSELPETEYSLRAFCGILYMKPRMKIFLRQKKVTTQMIAKS
LANVEYDTYKPTFTNKQVRITFGFSCKNSNQFGIMMYHNNRLIKSFEKVGCQVKPTRGEG
VGVIGVIECNFLKPAYNKQDFEYTKEYRLTINALAQKLNAYWKEKTSRDNFETSTVARPI
LKVPDQTWVQCDECLKWRKLPGKIDPSMLPARWFCYYNSHPKYRRCSVPEEQELIDEDLC
LSKAKKQEQTVEEKKKMPMENENHQVRGSAHPYCSHTTFSPAENITSLNMGSLTYNLISS
SCSKYKWILGEEPVEKRRRLQNDMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSER
STPPYLFPEYPEASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQMPRLVAEESNRGST
TINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAA
ISAAAIGEKGRGYEESEGHNTPKMKNQRELEELKRTTEKLERVLAERNLFQQKVEELEQE
RNHWQSEFKKVQHELVIYSTQEAEGLYWSKKHMGYRQAEFQILKAELERTKEEKQELKEK
LKETETHLEMLQKAQVSYRTPEGDDLERALAKLTRLRIHVSYLLTSVLPHLELREIGYDS
EQVDGILYTVLEANHILD
Download sequence
Identical sequences ENSNLEP00000016813 ENSNLEP00000016813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]