SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017060 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017060
Domain Number 1 Region: 2-354,384-404
Classification Level Classification E-value
Superfamily Thiolase-like 2.03e-74
Family Thiolase-related 0.002
Further Details:      
 
Domain Number 2 Region: 2187-2463
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.26e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000121
Further Details:      
 
Domain Number 3 Region: 1638-1799
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.08e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000943
Further Details:      
 
Domain Number 4 Region: 491-617,679-776
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.94e-40
Family FabD-like 0.0053
Further Details:      
 
Domain Number 5 Region: 1882-2066
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.23e-25
Family Tyrosine-dependent oxidoreductases 0.001
Further Details:      
 
Domain Number 6 Region: 1209-1398
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.07e-18
Family UbiE/COQ5-like 0.036
Further Details:      
 
Domain Number 7 Region: 1555-1673
Classification Level Classification E-value
Superfamily GroES-like 6.02e-17
Family Alcohol dehydrogenase-like, N-terminal domain 0.0057
Further Details:      
 
Domain Number 8 Region: 2095-2151
Classification Level Classification E-value
Superfamily ACP-like 0.0000000017
Family Acyl-carrier protein (ACP) 0.00048
Further Details:      
 
Domain Number 9 Region: 617-672
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000759
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017060   Gene: ENSNLEG00000014036   Transcript: ENSNLET00000017920
Sequence length 2473
Comment pep:novel supercontig:Nleu1.0:GL397368.1:786503:803602:-1 gene:ENSNLEG00000014036 transcript:ENSNLET00000017920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINILLKPNTSVQFLRLGMLSPEGTCKAFDAAGDGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPELNGITRALCATRQEPLLIGSTKSNMGHPEPVSGLAALAKVLLSLEHGLWAPNLHFHS
PSPEIPALSDGRLQVVAQPLPVRGGNVGINSFGFGGSNVHVILRPNTQPPPAPAPHATLP
RLLRASGRTPEAVQKLLEQGLQHSQDLAFLSMLNDIAAVPTTAMPFRGYAVLGGERGGPE
VQQVPAGKRPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLST
DEGTFDDIVHSFVSLTAIQIGLIDLLSCVGLRPDGIIGHSLGEVACGYADGCLSQEEAVL
AAYWRGQCIKEAHLPLGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFEF
VEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQALKKVIREPKPRSARWLSTSIPEAQ
WHGSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCTI
IPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSLT
WDVPAAEDFPNGSGSPSAAVYNIDTSSESPDHYLVDHTLDGRVIFPATGYLSIVWKTLAR
ALGLAIEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLIVSGKVYQW
DDPDPRLFDLPESPTPNPAEPLFLAQAEVYRELRLRGYDYGPHFQGILEASLEGDSGKLL
WKDNWVSFMDTMLQMSILGLAKHGLHLPTRITAIHIDPATHRQKLYTLQDKAQVADVVVS
RWLSVTVAGGVHISRLHTESAPRRQQEQHVPILEKFCFTPHMEEGCLSERTALQEELQLC
KGLAQALQTKVTQQGLKMAVPGLDGAQVPRDPSQQELPRLLWAACRLQLNGNLQLELAQV
LAQERPKLPEDPLLSGLLDSPALKACLDTAFENMPSPKMKVVEVLAGHGHLYSRIPGLLS
PHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVAA
LGDPASALSNMVAALREGGFLLLHTLLRGHPLGDTMAFLTSAEPQYGQGILSQDSWESLF
SRVSLRLVGLKKSFYGSTLFLCRRPSPQGSPIFLPVDDTSFRWVESLKGILADEDSSQPV
WLKAINCSTSGVVGLVNCLRQELGGHRLRCVLLSNLSSTSRVPEVDPGSAELQKVLQGDL
VMNVYRDGAWGAFRHFLLEEDKPEELTAHAFVTTLTRGDLSSIRWVCSSLRHAQPTHPGA
QLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAEG
LATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETVLIHSGSGGVG
QAAIAIALSLGCRVFTTVGSAEKRVYLQARFPQLDSTSFANSRDTSFEQHVLRHTGGKGV
DLVLNSLAEEKLQASVRCLAMHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFFN
GSSADWREVSALVQAGIRDGVVRPLKCTVFPGAQVEDAFRYMAQGKHIGKVVVQVLAEEP
EAVLKGAKPKLMSAISKTFCPAHKSYIITGGLGGFGLELAQWLIQRGVQKLVLTSRSGIR
TGYQAKQVRRWRRQGVQVQVSTSNVSSLEGARGLIAEAAQLGPVGGVFNLAVVLRDALLE
NQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVRAAPGSSLLAAGSWDIAVA
ALCAQFPHLQSQGAGAGVTVVMVLWEMHSPRTPGCQPCPTQAVPVPPLELRPSASLPGIR
DLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADAAN
ELASPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFH
SLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMC
SQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDM
EHNKVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAALSFYYKLRAAEQYTPKAK
YHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSIHVIEGDHRTLLEGSGLESIVSIIH
SSLAEPRVSVREG
Download sequence
Identical sequences ENSNLEP00000017060 ENSNLEP00000017060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]