SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017067 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017067
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000432
Family LysM domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017067   Gene: ENSNLEG00000013998   Transcript: ENSNLET00000017927
Sequence length 942
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:17487806:17641234:1 gene:ENSNLEG00000013998 transcript:ENSNLET00000017927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAIATRTHTGKEDANTVVLEPDKCNIAVE
EEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYIAGN
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKILTSDSRPTVPLEKSTEHTPT
KPSGSSVSEKLKKLDSSRETSHGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLE
ELSSQTDGGMDKKDTSKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDVELKG
ALDLETCEKQDIMPEVDKRSGSPESRVENTLNIHEDLDKVKLIEYYLNKNKEGPQVSENL
QKTELSDGKTIEPGGIDITLSSSLSQAGDPVTEGNKEPDKTWVKKGEPLPVKLNSSTEAN
VIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFLC
IKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAK
EQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRPHS
ALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDN
QIFGAYATHPFRFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGR
FGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFE
Download sequence
Identical sequences G1RUZ0
ENSNLEP00000017067 XP_003255713.1.23891 XP_003255715.1.23891 XP_003255716.1.23891 ENSNLEP00000017067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]