SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017190 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017190
Domain Number 1 Region: 362-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-80
Family Eukaryotic proteases 0.00000000263
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-32
Family Kringle modules 0.00000873
Further Details:      
 
Domain Number 3 Region: 210-298
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-27
Family Kringle modules 0.00000691
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 3.36e-19
Family GLA-domain 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017190   Gene: ENSNLEG00000014150   Transcript: ENSNLET00000018053
Sequence length 622
Comment pep:known_by_projection supercontig:Nleu1.0:GL397449.1:843669:861556:1 gene:ENSNLEG00000014150 transcript:ENSNLET00000018053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQALSLLQRVRRANSAFLEEVRRGNLERE
CVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGH
VNITWSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDNSTTGPWCYTTDPTVRRQ
ECSIPVCGQDQVTVAMTPRSGDSSVNLSPPSEQCVPDRGRQYQGRLAVTTHGFPCLAWAS
AQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEET
GDGLDEDPDRSVEGRTATSEYQTFFDPRTFGSGEADHLRGGVQGQPGQNGKTQSLLKMQK
SARCSSTCDCTIALQPGQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNMEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVVFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTASVGKVQPSVLQVVNLPIVERPVCKGST
RIRITDNMFCAGNSIYSWKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences ENSNLEP00000017190 ENSNLEP00000017190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]