SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017341 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017341
Domain Number 1 Region: 440-696
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1354-1611
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-57
Family YWTD domain 0.00000316
Further Details:      
 
Domain Number 3 Region: 742-998
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000145
Further Details:      
 
Domain Number 4 Region: 1049-1302
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-47
Family YWTD domain 0.00000297
Further Details:      
 
Domain Number 5 Region: 353-432,700-736
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-20
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 263-303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 227-265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 67-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 10 Region: 308-344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 1308-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000158
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 12 Region: 103-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 13 Region: 186-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 1004-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000902
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017341
Domain Number - Region: 1611-1648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017341   Gene: ENSNLEG00000014206   Transcript: ENSNLET00000018208
Sequence length 1904
Comment pep:known_by_projection supercontig:Nleu1.0:GL397449.1:981183:1046680:-1 gene:ENSNLEG00000014206 transcript:ENSNLET00000018208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRWGALLLRALLCAHGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHS
DEDGCMLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGY
CIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEES
CPSAVPAPPCNLEEFQCAYGHCILDIYHCDGDDDCGDWSDESDCASHQPCRSGEFMCDSG
LCINAGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDE
ENCENTGSPQCASDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVN
NGGCAQKCQMVRGVVQCTCHTGYRLTEDGHTCQDVNECAEEGYCSQGCTNSEGAFQCWCE
TGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRREL
VFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLD
GAHRKVLLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPN
GLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTK
SINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYT
CACPTGFRKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWD
SRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIE
VANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSN
LTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWT
DWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAVENGGCSHLCLRSP
NPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITMK
NTIAIGVDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWT
DTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSD
RAVLINNNLGWPNGLTVDKTSSQLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTLL
DSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGPRNGGCS
HLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPV
PELNNVISLDFDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARN
LYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANL
DGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPFA
LTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIAVSPQRQTGTNACGVNN
GGCTHLCFARASDFVCACPDEPDSRPCSFVPGLVPPAPRATGMSEKSPVLPNTPPTTLHS
STTRTRTSLEEVEGRCSERDARLGLCARSNEAVPAAPGEGLHISYAIGGLLSILLILVVT
AALMLYRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHN
YTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTE
TEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
Download sequence
Identical sequences G1RVR4
ENSNLEP00000017341 ENSNLEP00000017341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]