SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017383 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017383
Domain Number 1 Region: 431-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 316-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 355-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 278-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 389-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000032
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017383   Gene: ENSNLEG00000014294   Transcript: ENSNLET00000018250
Sequence length 588
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:2123693:2134739:-1 gene:ENSNLEG00000014294 transcript:ENSNLET00000018250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPRMSRLLSQTVILALIFLPQARPAGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFF
RVCLKPGLSEEAAESPSPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPG
TFSLIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAAWELRFSYRARCE
PPAVGTACTRLCRPHSAPSRCSPGLRPCAPLEDECEAPPVCRAGCSPEYGFCEQPGECRC
LEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPGSFECA
CPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSL
RPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCAL
GFGGRDCRERADPCASRPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAA
PSGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHAQDAGSRLLAGTPEPSVHA
LPDALNNLRTQEGPGDGPSPSVDWNRPEDVDPRGIYVISAPSIFAREA
Download sequence
Identical sequences G1RVV6
ENSNLEP00000017383 ENSNLEP00000017383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]