SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017422 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017422
Domain Number 1 Region: 1099-1227
Classification Level Classification E-value
Superfamily TNF-like 1.2e-25
Family TNF-like 0.0016
Further Details:      
 
Domain Number 2 Region: 1041-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017422
Domain Number - Region: 901-957
Classification Level Classification E-value
Superfamily Proteasome activator 0.0222
Family Proteasome activator 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017422   Gene: ENSNLEG00000014338   Transcript: ENSNLET00000018291
Sequence length 1228
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:41839235:41899020:-1 gene:ENSNLEG00000014338 transcript:ENSNLET00000018291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGARLFVLLCSLWSGGIGLNNSKYSWTIPGDGNSQKTMPSASVPPNKTQSLQILPTTRV
MSVEIATTPEARTIEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAERVVKSQNLTLPTN
ASIKFNPGAESVVLSNSTLKFLQSFARKSNEQATSLNAVGGTGGVGGVGGTGGVGNRTPR
ETYLSRGDSSSSQRTDYQKSNFETTRGKNWCAYVHTRLSPTVILDNQVTYVPGGRGPCGW
TGGSCPQRSQKISSPVYRMQHKIVTSLDWRCCPGYSGPKCQLRAQEEQHLIHSNQAESHT
AVGRGVAEQQQWQGCGDPEVMQKMTDQVNYQAMTLTLLQKKIDNISLTVNDVRNTYSSLE
GKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAHLFKTVSSLSEDL
ESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKQ
LEVKQTHLEGALEQEHSRSILYYESLNKTLSNLKEVHEQLLSSEQVSDQKNVPAAESVSN
NVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTISLEMEKESLRGECEDMLSKCR
NDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLR
QTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQSRDDALERHINEY
ALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFQ
RLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSDFQKMYQIFNETTSQVRKYQQN
MSHLEEKILLTTKISKNFETRLQDIESKVTQTLIPYYISLKKGSMVTNERDQALQLQVLN
SRFKALEAKSIHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIRKWIKHSLPDIQLLQ
KGLTEFVEPIIQIKTQAILSNLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVN
LTTVLIGRTQRNTDNIIYPEEYSSCSQHPCQNGGTCINGRASFTCACRHPFTGDNCTIKL
VEENALAPDFSKGSYRYAPMVAFFASHTYGMTTPGPILFNNLDVNYGASYTPRTGKFRIP
YLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGDALLELNYGQE
VWLRLAKGTIPAKFPPVTTFSGYLLYRT
Download sequence
Identical sequences G1RVZ5
ENSNLEP00000017422 XP_003257586.1.23891 ENSNLEP00000017422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]