SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017437 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017437
Domain Number 1 Region: 53-427
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.49e-47
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 552-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017437   Gene: ENSNLEG00000014328   Transcript: ENSNLET00000018306
Sequence length 661
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:31409258:31574001:-1 gene:ENSNLEG00000014328 transcript:ENSNLET00000018306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSADPGMSRMLLFLLLLSFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAV
TDVDHDGDFEIVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTAC
DIDGDGREEIYFLNTNNAFSGVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSV
ACVDRKGSGRYSIYIANYAYGNVGPDALIEMDPEASDLSRGILALRDVAAEAGVSKYTGG
RGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADF
NRDGKVDIVYGNWNGPHRLYLQMSAHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELE
IFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL
ILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGG
SGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASSEMNSVLEILYPRDEDTLQDP
APLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKRCSRGYEPNE
DGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSAVKESCEPS
C
Download sequence
Identical sequences G1RW10
XP_003255360.1.23891 ENSNLEP00000017437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]