SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017467 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017467
Domain Number 1 Region: 93-304
Classification Level Classification E-value
Superfamily DNA-glycosylase 7.38e-55
Family Mismatch glycosylase 0.000085
Further Details:      
 
Domain Number 2 Region: 352-489
Classification Level Classification E-value
Superfamily Nudix 3.3e-28
Family MutY C-terminal domain-like 0.00000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017467   Gene: ENSNLEG00000014360   Transcript: ENSNLET00000018337
Sequence length 546
Comment pep:known_by_projection supercontig:Nleu1.0:GL397442.1:2156233:2170085:-1 gene:ENSNLEG00000014360 transcript:ENSNLET00000018337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLVSRLSRLWAIMRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDACAGMIPE
CPGAPAGLARQPEEVVLQASVSSYHLFRDVAEVTAFRGSLLSWYDQAKRDLPWRRRAEDE
VDLDRRAYAVWVSEVMLQQTQVATVINYYTGWMQKWPTLQDLASASLEEVNQLWAGLGYY
SRGRRLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGPGDPTSPTLCV
PSLLSSQPKANSLAPLGLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCR
ARQRVEREQLLASRRLLGSPDVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPP
REESSATCVLEQPGALGAQILLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRW
AGPLPATRLRHLGEVVHTFSHIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHMAAVS
TAMKKALPFVFRVYQGQQPGTCTGSKRSQVPSPCSRKKPRMGQQVLDNFFRSHISTDAHS
LNSAAQ
Download sequence
Identical sequences ENSNLEP00000017467 ENSNLEP00000017467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]