SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017569 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017569
Domain Number 1 Region: 156-274
Classification Level Classification E-value
Superfamily DNA clamp 9.11e-18
Family DNA polymerase processivity factor 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017569
Domain Number - Region: 29-101
Classification Level Classification E-value
Superfamily DNA clamp 0.00817
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017569   Gene: ENSNLEG00000014437   Transcript: ENSNLET00000018444
Sequence length 283
Comment pep:known_by_projection supercontig:Nleu1.0:GL397369.1:5550666:5558921:-1 gene:ENSNLEG00000014437 transcript:ENSNLET00000018444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQQIQDEEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCV
QANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPL
MLFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQI
TMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSC
KVSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences G1RWE2
ENSNLEP00000017569 XP_003274989.1.23891 XP_004088254.1.23891 XP_012357162.1.23891 ENSNLEP00000017569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]