SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017624 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017624
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000091
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000439
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 820-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000877
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 782-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000094
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 746-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000746
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000249
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 707-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000069
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017624
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017624   Gene: ENSNLEG00000014487   Transcript: ENSNLET00000018502
Sequence length 1217
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:5122600:5158540:-1 gene:ENSNLEG00000014487 transcript:ENSNLET00000018502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCICPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEGMCARLQLPMATVLREGTHTWAEGFSTSGCVWGIFLSSPMEAG
QRLCSHHICQCYIGQSRYPRLDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANI
TFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDI
RDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVAW
ICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYEN
KNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNSTPTKHPNWTNKQD
NRDLESAQSLNRMEYIV
Download sequence
Identical sequences ENSNLEP00000017624 ENSNLEP00000017624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]