SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017640 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017640
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000314
Family LEM domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017640
Domain Number - Region: 67-110
Classification Level Classification E-value
Superfamily Bacterial enterotoxins 0.0223
Family Superantigen toxins, N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017640   Gene: ENSNLEG00000014492   Transcript: ENSNLET00000018519
Sequence length 181
Comment pep:known_by_projection supercontig:Nleu1.0:GL397353.1:7459801:7493945:-1 gene:ENSNLEG00000014492 transcript:ENSNLET00000018519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDR
AQDSDDSKELNIILQGNIILSTEKSKKLKNWPEASTIKPKAVDIYCLDYKPSKGRRWAAR
APSTRITYVTITKERDYCVEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSPF
G
Download sequence
Identical sequences G1RWL3
ENSNLEP00000017640 XP_003273220.1.23891 ENSNLEP00000017640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]