SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017717 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017717
Domain Number 1 Region: 287-493
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-68
Family Eukaryotic proteases 0.0000998
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-19
Family Hepsin, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 154-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017717   Gene: ENSNLEG00000014558   Transcript: ENSNLET00000018600
Sequence length 498
Comment pep:known_by_projection supercontig:Nleu1.0:GL397505.1:502409:522579:-1 gene:ENSNLEG00000014558 transcript:ENSNLET00000018600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVGPKPLPTLLCGGRTGHRMAWILSFLIRSCPCEPGKGCVYGKPVILWPTISSVVPST
FLGLGNYEVEVEVEPDVRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAV
AAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCDGVS
DCKDGEDEYRCVRVSGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNL
RVSSLEGQFREKFVSINHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSR
IVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIVTAAHCVYDLYLPKSWTIQVGLVS
LLDNSAPSHLVDNIAYHSKYKPKRLGNDIALMKLAGPLTFNEMIQRVCLPNSEENFPDGK
VCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLKGGVDS
CQGDSGGPLVCQERRLWK
Download sequence
Identical sequences ENSNLEP00000017717 ENSNLEP00000017717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]