SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017895 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017895
Domain Number 1 Region: 8-486
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-161
Family ALDH-like 0.0000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017895   Gene: ENSNLEG00000014713   Transcript: ENSNLET00000018787
Sequence length 487
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:26645441:26679270:-1 gene:ENSNLEG00000014713 transcript:ENSNLET00000018787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCKVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVGIPSDPLVSMGALISKEHLEKVRSYVKRALAEGAQIWCGEGVDK
LSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences G1RXB8
ENSNLEP00000017895 XP_003255799.1.23891 ENSNLEP00000017895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]