SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017921 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017921
Domain Number 1 Region: 544-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000119
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017921
Domain Number - Region: 499-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017921   Gene: ENSNLEG00000014723   Transcript: ENSNLET00000018814
Sequence length 591
Comment pep:known_by_projection supercontig:Nleu1.0:GL397299.1:12471317:12508101:-1 gene:ENSNLEG00000014723 transcript:ENSNLET00000018814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNSRTWAWRTPVELFLLCAALGCLSLPGSRGERPHSFESNAVNKSFAKSRQTRSVDVTL
MPIDCELSGWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ESNVIEKVASRSGFSFGFKISGIFELGISSQNDRGKYYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKSRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKESMERGDYTLNNVHACAKNDFKIGGAIEEVYVRLGVSVGKCRGILNEIKDRNKRDTIV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVKQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NMPIDGNWNCWSNWSSCSGGHKTRQRQCNNPPPQNGGSPCSGPVSETLDCS
Download sequence
Identical sequences XP_003265184.1.23891 ENSNLEP00000017921 ENSNLEP00000017921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]