SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017925 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017925
Domain Number 1 Region: 544-820
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-86
Family Eukaryotic proteases 0.0000983
Further Details:      
 
Domain Number 2 Region: 333-437
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000419
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 69-151
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000497
Family SEA domain 0.0063
Further Details:      
 
Domain Number 4 Region: 482-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 231-315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000017
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 6 Region: 518-556
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000575
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 447-479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017925   Gene: ENSNLEG00000014738   Transcript: ENSNLET00000018818
Sequence length 821
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:17056523:17100626:-1 gene:ENSNLEG00000014738 transcript:ENSNLET00000018818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAEAPQVAGGQGDGGDGEEAEPEGMFKAREDSKRKALHLVPLFVLLALYLLNTSVLVN
WHIPWYKAEVTVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELIASTRLG
TYYNSSSVYSFGEGPLTCFFWFILQIPEHRQLMLSPEVVQALLVEELLSTVNSSAAVPYR
AEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLASSCLWHLQGP
EDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVLASGAIMAVVW
KKGLHSYYDPFVLSVQPVVFQACEVNLTLDDRLDSQGILSTPYFPSYYSPRTHCSWHLTV
PSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAERIPVVATAGITI
NFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNCVCR
ATFQCQEDSTCISLPKVCDGQPDCLNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNPQCD
GQPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWV
ITAAHCFQEDSMTSPVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALL
QLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGALGTDAVALFYGWRNQGSE
TCCWPISNALQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKA
LSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Download sequence
Identical sequences ENSNLEP00000017925 ENSNLEP00000017925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]