SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018249 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018249
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.66e-28
Family C-type lectin domain 0.000000372
Further Details:      
 
Domain Number 2 Region: 262-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-16
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 565-630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.44e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 441-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 200-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 7 Region: 503-569
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 8 Region: 378-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 9 Region: 642-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 697-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 11 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018249   Gene: ENSNLEG00000015004   Transcript: ENSNLET00000019157
Sequence length 830
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:19930680:19971546:-1 gene:ENSNLEG00000015004 transcript:ENSNLET00000019157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCQKAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTKEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGVWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTATAPVCKAVQCQHLEAPNEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSMRAFQYDTNCSFHCAEGF
MLRGAHIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGVFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGFSLSGPERLDCTRLGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCNKGFKLEGPNNVECTTSGRWSATPPTCKGIASLPSPGVQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLTGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIVMNCSNL
WGNFSYGSICSFHCLEGQLLNGSEQTACQENGHWSTTMPTCQAGPLTVQEALTYFGGAVA
STTGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences G1RYC2
XP_003258893.1.23891 ENSNLEP00000018249 ENSNLEP00000018249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]