SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018283 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018283
Domain Number 1 Region: 45-121
Classification Level Classification E-value
Superfamily Homeodomain-like 2.52e-26
Family Homeodomain 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018283   Gene: ENSNLEG00000015040   Transcript: ENSNLET00000019192
Sequence length 302
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:35827661:35838925:-1 gene:ENSNLEG00000015040 transcript:ENSNLET00000019192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKK
KQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKR
ERSQQAELCKGSFAAPLGGLVPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVG
PLASQPVFSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGGPPGLAPAAVSSGAVSCPYA
SAAAAAAAAASSPYVYRDPCNSSLASLRLKAKQHASFSYPAVHGPPPAANLSPCQYAVER
PV
Download sequence
Identical sequences A0A0D9QZH5 A0A2K5MIE7 G1RYF6 G3RR65 H2NBE8 H2Q2H1 O75364
ENSPPYP00000003020 ENSP00000359019 ENSP00000439383 ENSPTRP00000005086 ENSNLEP00000018283 gi|4826912|ref|NP_005020.1| 9598.ENSPTRP00000005086 9600.ENSPPYP00000003020 9606.ENSP00000359019 ENSGGOP00000018289 ENSP00000359019 ENSPTRP00000005086 NP_005020.1.87134 NP_005020.1.92137 XP_002821135.1.23681 XP_003255438.1.23891 XP_004050060.1.27298 XP_007962142.1.81039 XP_011907011.1.92194 XP_015003550.1.72884 XP_016774698.1.37143 XP_521591.2.37143 ENSPPYP00000003020 ENSNLEP00000018283 ENSP00000359019 ENSP00000439383 ENSGGOP00000018289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]