SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018295 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018295
Domain Number 1 Region: 407-521,643-789
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.76e-64
Family Phosphate binding protein-like 0.00000000195
Further Details:      
 
Domain Number 2 Region: 18-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.75e-52
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 545-640
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000746
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018295   Gene: ENSNLEG00000015037   Transcript: ENSNLET00000019204
Sequence length 878
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:18647504:18960198:1 gene:ENSNLEG00000015037 transcript:ENSNLET00000019204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGGEESRLFGSLLWTLPWRGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVD
HLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQ
FVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNI
KDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDIL
LERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILV
IAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYG
RRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTIVVTTILESPYV
MYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGE
LVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAF
MQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE
IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLL
ESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKN
KWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKR
MKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences ENSNLEP00000018295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]