SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018300 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018300
Domain Number 1 Region: 195-272
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.56e-19
Family Middle domain of MutM-like DNA repair proteins 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000018300
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0647
Family N-terminal domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number - Region: 278-320
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0684
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018300   Gene: ENSNLEG00000015054   Transcript: ENSNLET00000019209
Sequence length 332
Comment pep:known_by_projection supercontig:Nleu1.0:GL397337.1:10568994:10588486:1 gene:ENSNLEG00000015054 transcript:ENSNLET00000019209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPLVRKFHRLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDPDE
AMGPPGSSPPPEPPQKEAQNEGAADPMQVGEPSGQKTPDGSSQSAELGPQGEDDSEYLER
DAPAGDAGRWLCVSFGLFGSVWVNEFSRAKKANKRGDWRDPSPRLVLHFGGGGFVAFYNC
QMSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYR
AGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFEGKPQHTQVYQKEQCPAGHQVMKE
AFGPQNGLQRLTWWCPQCQPQLSEEPEQRQFS
Download sequence
Identical sequences A0A2I3H6M1
XP_003271487.1.23891 XP_004088004.1.23891 ENSNLEP00000018300 ENSNLEP00000018300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]