SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018355 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018355
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily FKBP-like 7.46e-34
Family FKBP immunophilin/proline isomerase 0.00019
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000391
Family Calbindin D9K 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018355   Gene: ENSNLEG00000015107   Transcript: ENSNLET00000019268
Sequence length 211
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:9952066:9968542:-1 gene:ENSNLEG00000015107 transcript:ENSNLET00000019268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLGNAVLTLFVSSLIGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences A0A2I3H2P8
XP_003270523.1.23891 ENSNLEP00000018355 ENSNLEP00000018355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]