SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018625 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018625
Domain Number 1 Region: 53-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 12-43
Classification Level Classification E-value
Superfamily PKD domain 0.0000497
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018625   Gene: ENSNLEG00000015348   Transcript: ENSNLET00000019556
Sequence length 245
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:41821896:41866643:-1 gene:ENSNLEG00000015348 transcript:ENSNLET00000019556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVPQSGTLKLSHLQEGTYTFQLTVTDTAGQRSSDNVSVTVLRAAYSTGGCLHTCSRYHF
FCDDGCCIDITLTCDGVQQCPDGSDEDFCQNLGLDRKMVTHTAASPALPRTTGPSEDAGG
DSLVEKSQKATAPNKPPALSNTEKRNHSAFWGPESQIIPVMPDSSSSGKNRKEESYIFES
KGGGGGREHPAPETGAVLPLALGLAITALLLLMVACRLRLVKQKLKKARPITSEESDYLI
NGMYL
Download sequence
Identical sequences XP_003255918.1.23891 ENSNLEP00000018625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]