SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019084 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019084
Domain Number 1 Region: 33-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 163-286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-18
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 285-321
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019084   Gene: ENSNLEG00000015738   Transcript: ENSNLET00000020045
Sequence length 514
Comment pep:known_by_projection supercontig:Nleu1.0:GL397494.1:643430:696686:-1 gene:ENSNLEG00000015738 transcript:ENSNLET00000020045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNKE
CIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIR
STGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSS
QVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSSIENL
KAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLFTSFVEPPCTSSTFFCHSNMCIN
NSLVCNGVQNCAYPWDENHCKEKKKAGVFEQITKTHGTIIGITSGIVLVLLIISILVQVK
QPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTA
SRCVHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHEC
PEQALEDRVMEEIPCEIYVRGREDSTQASISIDF
Download sequence
Identical sequences ENSNLEP00000019084 ENSNLEP00000019084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]