SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019359 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019359
Domain Number 1 Region: 1344-1410
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-20
Family TB module/8-cys domain 0.00000796
Further Details:      
 
Domain Number 2 Region: 1518-1579
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1124-1251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 670-725
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000981
Family TB module/8-cys domain 0.00081
Further Details:      
 
Domain Number 5 Region: 873-998
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000502
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 6 Region: 550-620
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000275
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 7 Region: 964-1122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000675
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 1244-1297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000623
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 616-664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000939
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1622-1707
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000149
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1462-1507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 1422-1471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000303
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 401-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019359
Domain Number - Region: 188-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000287
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1038-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.0082
Further Details:      
 
Domain Number - Region: 1289-1315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0144
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019359   Gene: ENSNLEG00000015915   Transcript: ENSNLET00000020338
Sequence length 1721
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:12579322:13029055:1 gene:ENSNLEG00000015915 transcript:ENSNLET00000020338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAWLRWGLLLWAGLLASSTHGRVRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNA
RYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPEPARPAAPGGQLHPKP
GGHPAAAPFAKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKAPG
SQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETISAQDTSSPVFGGQSPGAASSW
GPPEQAAKHTSSKKADSLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVMIHHG
QTQEYVLKPKYFPAQKGILGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSICK
VTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCP
PNFTGKLCQIPVHGASVPKLYQQSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPPNI
VNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSHQQ
VIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKKPS
YHGYNQMMECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDPTF
SSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGT
GKTCPAVCAXXXXXXXXXXXRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEPV
EALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGVSTIHLHPQFPGI
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCIC
YEGYKFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDE
CLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSY
QCVPCTEGFRGWNGQCLDVDECLEPNVCTNGDCSNLEGSYMCSCHKGYTRTPDHKHCKDI
DECQQGNLCINGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEG
SFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTC
QDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEY
SPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGW
GDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGF
CLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLD
ASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGM
QCALCPMKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYAPEADPYFIQDRFLNSFEEL
QAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLKKDSDLE
Download sequence
Identical sequences ENSNLEP00000019359 ENSNLEP00000019359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]