SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019530 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019530
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.49e-75
Family Inorganic pyrophosphatase 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019530   Gene: ENSNLEG00000016098   Transcript: ENSNLET00000020519
Sequence length 178
Comment pep:novel supercontig:Nleu1.0:GL397335.1:4432232:4454505:-1 gene:ENSNLEG00000016098 transcript:ENSNLET00000020519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNVCNSVVIL
Download sequence
Identical sequences G1S1Z2 Q5SQT6
ENSP00000362327 ENSNLEP00000019530 ENSNLEP00000019530 ENSP00000362327 ENSP00000476559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]