SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019720 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019720
Domain Number 1 Region: 1182-1227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 1361-1394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000314
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019720
Domain Number - Region: 1458-1490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1490-1521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000733
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1426-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00182
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1554-1585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00384
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1394-1424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1522-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0247
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 1218-1246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019720   Gene: ENSNLEG00000016235   Transcript: ENSNLET00000020712
Sequence length 1590
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:34671514:34749773:-1 gene:ENSNLEG00000016235 transcript:ENSNLET00000020712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGAWALATALMLLAPGEAQECSPGGHQFLRSPYRSVHFDSWHLQQSAVQDLICDHSLT
PGWYRFLIFDRPAEMPTKCVETNHCGTQAPVWLSLRDSETLPSPGEIKQLTACATWQFLF
STTKDCCLFQIPVSVRNCGNFFVYLLQPTQGCMGYCAEAISDAQLHPCGSDETEIGGDCV
RQLAASLPPPPAGRPEVLVELIESRLFCRCSFDVPPTNNSVGFHIAWSRLSSQEVKEELK
QETTVQAFSLLELDGINLRLGDRIFCSASVFFLENPHVQSVAIESQEFFAGIKLQPELST
ISEDGKEYYLKIESTVPIICSEFSELGQECKISLKLKTIDQGREHLGLNLALSSCHVDLL
QTSSCANGTCSHTFVYYTAVTDFSRDGDRVTNIVVQPIVNEDFLWNNYIPDSIQIKVKDV
PTAYCYSFTDPHIITFDGRVYDNFKTGTFVLYKSMSRDFEVHVRQWDCGSLHYPVSCNCG
FVAQEGGDIVTFDMCNGQLRESQPYLFVKSQDVTRNIKISESYLGRKVTIWFSSGAFIRA
DLGEWGMSLTIRAPSVDYRNTLGLCGTFDENPENDFHDKNGIQIDQNFNNYVAFINEWRI
LPGKSMFDTLPISMTSPGKPSYCSCSLDTAAYPSSDDLDSVSQSEIALGCKDISHVSLSS
LIPALDVTSEYINSDTLFREINKHTSPEEYNLNFFPQEKKHINLTKRGLNVQKHPGNEKQ
DALKYLDNKKYTQGRGSHSQEMRYNRQNRWKRQNFYEFLPLFAFPSLSQTDLEELTYFFP
EDHAEDVQQEFFPSWPTPSGITEYSTLTLCQQTLANSSIGRLCLAFLGKRVDSVIDMCVK
DVLLKDDLSWAEAGVALLENECEKRIVEEGKYNTEEYGTSIEDILLVLKCPNLCSGNGQC
MEWGCACSPSFSSYDCSDSHDKAPEITELGNAGFCDVQKYNCMMVRVFGRGFKELPSIKC
EVTKLQYNSSEWMPGEPIYTQTIFQNSRAVDCQLPTDVQQFDTMDLVGGKPTGKWQLKVS
NDGYKFSNPKIMVIYDGACQVCGLYKNDSCTIKENVCIIEGLCYVEGDKNPTSPCLICRP
QISRFTWSFLENNQPPVIQALQDKLQTFYGENFEYQFMAFDPEGSDIHFTLDSGPEGASV
SSAGLFMWKTELLTPQQFTLRLNDDCDAETRVMIEVTVKSCDCLNGGSCVSDRNFSPGSG
VYLCVCLPGFHGSLCEVDISGCQSNPCGLGSCISGFHSYSCDCPPELKVETQFLNKFTTQ
TVVLTRSDKSVNKEEDDKNDQGRKRHVKPTSGNALTICRYPCGKSRECVAPNICKCKPGY
IGSNCQTAVCDPDCKNHGKCIKPNICQCLPGHGGATCDEEHCNPPCQHGGTCLAGNLCTC
PYGFVGPRCETMVCNRHCENGGQCLTPDICQCKPGWYGPTCSTALCDPVCLNGGSCNKPN
TCLCPDGFFGEQCQNAFCHPPCKNGGHCMRNNVCVCREGYTGRRCQKSICDPMCMNGGKC
VGPSTCSCPSGWSGKRCNTPICLQKCKNGGECIVPSICHCPSSWEGVQCQIPICNPKCLY
GGRCIFPNVCSCRTEYSGVKCEKKIQIRRH
Download sequence
Identical sequences G1S2I2
ENSNLEP00000019720 ENSNLEP00000019720 XP_003252617.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]