SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019754 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019754
Domain Number 1 Region: 96-388
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 3.53e-66
Family Glutaminase/Asparaginase 0.0000012
Further Details:      
 
Domain Number 2 Region: 425-584
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-30
Family Ankyrin repeat 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019754   Gene: ENSNLEG00000016278   Transcript: ENSNLET00000020748
Sequence length 591
Comment pep:known_by_projection supercontig:Nleu1.0:GL397390.1:3468438:3487497:1 gene:ENSNLEG00000016278 transcript:ENSNLET00000020748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPSPPLQAGVGRRLLGVAHPDPHPCLWGGLQVEGGLGAVPGMLRTCYVRSPWHRGPSSA
RGEPSWSGHLEQEEVQSESLLFRLLLFLSRSPASHNQRILYTVLECQPLFDSSDMTIAEW
VRVAQTIERHYEQYHGFVVIHGTDTMAFAASMLSFMLENLQKTVILTGAQVPIHILWSDG
RENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADIT
INRELVRKVDGKAGLVVHSSMEQDVGLLRLYPGIPAALIPAGWEPPLLATLWENVGGAAP
SSPTVLGAEQAPAAPGLGPHPTAPQVRAFLQPPLKGMVMAGAGVIGFDMTSEAALAKLSY
VLGQPGLSLDDRKQLLTKDLRGEMTPPSVEEHRPSLQGNTPGRGVSWLLSLSGSQEADAL
RNALMPSLACAAAHAGDLEALQALVELDSELGLVDFNGQTPLHAAVRGGHAEAVTMLLQR
GVDVNTRDTDGFSPLLLAVRGRHPGVIGLLREAGASLSTQELEEAGTELCRLAYRADLEG
LQVWWQAGADLRQPGYDGHSALHVAEAAGNLAVVAFLQSLEGTVGAQAPCP
Download sequence
Identical sequences ENSNLEP00000019754 ENSNLEP00000019754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]