SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019757 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019757
Domain Number 1 Region: 670-738
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-20
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1574-1633
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-16
Family TB module/8-cys domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1408-1464,1492-1500
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.16e-16
Family TB module/8-cys domain 0.0003
Further Details:      
 
Domain Number 4 Region: 856-973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000392
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 554-618
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000131
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 6 Region: 940-1053
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 1181-1302
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000073
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1098-1215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 619-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000639
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 10 Region: 1296-1351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000314
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 11 Region: 1728-1813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000115
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 12 Region: 1478-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 13 Region: 1517-1562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000738
Family EGF-type module 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019757
Domain Number - Region: 403-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 192-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00131
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 1339-1380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019757   Gene: ENSNLEG00000016271   Transcript: ENSNLET00000020751
Sequence length 1816
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:11603268:11713592:-1 gene:ENSNLEG00000016271 transcript:ENSNLET00000020751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRTKARSPGRALRNPWRGFLPLTLALFVGAGHAQRDPVGRNEPAGGDANRLRRPGGSY
PAAAAAKVYSLFREQDAPVAGLQPVERAQPGWGSPRRPTEAEARRPSRAQQSRRVEPAQG
AGGRRSVASGQVSPTPRTLRFTALALSGTESVSSQSPPSPTRGLICMRNVCGGQCCPGWT
TANSTNHCIKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPDEEFDPQNSRLAPRR
WAERSPNLRRSSAAGEGTLARAQLPAPQSPPAPQLPPAPQTLSGLSQTHPSQQHVGLSRT
VRLHPTATASSQLSSNALPPGPGLEQRDGTQQAVPLEHPSSPWGLNLTEKIKKIKIIFTP
TICKQTCAHGHCANNCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECW
CPANSTGKFCHLPIPQPDREPPGRGSRPRALLEAPLKQSTFTLPLSNQLASVNPSLVKVH
IHHPPEASVQIHQVAQVRGGVEEALVENSVETRPPPWLPASPGHSLWDSNNIPARSGEPP
RPLPPAAPRPRGLLGRCYLNTVNGQCANPLLELTTQEDCCGSVGAFWGVTLCAPCPPRPA
SPVIENGQLECPQGYKKLNLTHCQDINECLTLGLCKDAECVNTRGSYLCTCRPGLMLDPS
RSRCVSDKAISMLQGLCYRSLGPGTCTLPLAQQITKQICCCSRVGKAWGSECEKCPLPGT
EAFREICPAGHGYTYASSDIRLSMRKAEEEELARPPREQGQRSSGALPGPAERQPLRVVT
DTWLEAGTIPDKGDSQAGQVTTSVTHAPAWVTGNATTPPMPEQGIPEIQEEQVTPSTNVL
VTLSTPGIDRCAAGATNVCGPGTCVNLPDGYRCVCSPGYQLHPSQAYCTDDNECLRDPCK
GKGRCINRVGSYSCFCYPGYTLATSGATQECQDINECEQPGVCNGGQCTNTEGSYHCECD
QGYIMVRKGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCVDVNECLTP
GVCAHGKCTNLEGSFRCSCERGYEVTSDEKGCQGTEMSTPSPQASPACGSLPSAHHPWPP
ESTPGLASLFTLTQHIPAQTCPSPTPATCQSLAVLTCLSCRVPHRMQCPISDVDEYPQSS
CLGGECKNTVGSYQCLCPQGFQLANGTVCEDVNECMGEEHCAPHGECLNSHGSFFCLCAP
GFVSAEGGTSCQDVDECAATDPCLGGHCVNTEGSFNCLCETGFQPSPESGECVDIDECED
YGDPVCGTWKCENSPGSYRCVLGCQPGFHMAPNGDCIDIDECTNDTMCGSHGFCDNTDGS
FRCLCDQGFEISPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGH
CRPRGAGGQSISEAPTGDHAPAPTRMDCYSGQNGHAPCSSVLGRNTTQAECCCTQGASWG
DACDLCPSEDSAEFSEICPSGKGYIPVEGAWAFGQTMYTDADECVIFGPGLCPNGRCLNT
MPGYVCLCNPGFHYDASHKKCEDHDECQDLACENGECVNTEGSFHCFCSPPLTLDLSQQR
CMNSTSSMEDLPDHDIHMDVCWKKVTNDVCSEPLRGHRTTYTECCCQDGEAWSQQCALCP
PRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPDDLHYSIYGPDGAPFYNYLGPEDT
VPEPAFPNTAGHPGDRTPILESPLQPSELQPHYVASHPETPAGFEGLQAEECGILNGCEN
GRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCS
PGYVAEAGPPHCTAKE
Download sequence
Identical sequences ENSNLEP00000019757 ENSNLEP00000019757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]