SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020055 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020055
Domain Number 1 Region: 570-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000709
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 498-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 625-681
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020055
Domain Number - Region: 450-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020055   Gene: ENSNLEG00000016515   Transcript: ENSNLET00000021061
Sequence length 842
Comment pep:known_by_projection supercontig:Nleu1.0:GL397362.1:5111891:5192686:1 gene:ENSNLEG00000016515 transcript:ENSNLET00000021061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVISLFILVGFIGEFQIFSRASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEAGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYIKHTSTEHTSSSRKRFFFRSSSSSHSYTSHTKE
IHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYGT
HYLQSGSLGGEYRVLFYVDSEKLKQNDFSSVEEKKCKSSGWNFIVKFSSHGCKELENALK
GASETQNNVLRGNPFIRGGGAGFISGLSYLELDNPAGNKRRYSSWAESVTNLPEVIKQKL
TPLYELVKEVPCASVKKLYLKRALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYT
FGVACEQGVLVGNEAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPSPSGGGRSCIGETTE
STQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGYVQDEGTMFPVGKNVVYTCNE
GYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLTDGIQSHPQKPFYTVGEKVTVSCSG
GMSLEGPSAFLCGSSLKWSPEMKNARCVQKDNPLTQAVPKCQRWEKLQNSRCVCKMPYEC
GSSLDVCARDERSKRILPLTVCKMHVLHCQGRNYTLAGRDSCTLPASAEKACGACPLWGK
CDGESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCGGQSIFVTSIRPCAAE
TQ
Download sequence
Identical sequences G1S3G7
ENSNLEP00000020055 XP_003274433.1.23891 ENSNLEP00000020055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]