SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020213 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020213
Domain Number 1 Region: 251-754
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.02e-52
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 714-761,788-864
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000051
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020213   Gene: ENSNLEG00000016639   Transcript: ENSNLET00000021223
Sequence length 980
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:22188785:22355291:1 gene:ENSNLEG00000016639 transcript:ENSNLET00000021223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADLRRLAISEDHVAS
VKKSVSSKGQPSPRAAIPMSCITNGSGANRKPSHTSTVSIAGKETLSSAAKSGTEKKKEK
PQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKS
HNSWENSDDSRNKLSKIPSTPKLIPKVTKTTDKHKDVIINQEGEYIKMFMRGRPITMFIP
SDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPPTEIVYFIASVVVLFNYEERT
QRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVTLSTLQIIGLGT
FERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPTD
ANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGGVLTGDSGGVMLI
WSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLN
PEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLATH
PFKDLLLTCAQDRQVCLWNSVEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWFVLD
AETRDLVSIHTDGNEQLSVMRYSIDGNFLAVGSHDNFIYLYVVSENGRKYSRYGRCTGHS
SYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTTYTCVLGFQVFG
VWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNVS
FTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVVQSNTPTPP
PSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEGGSGDLGEPLYEEPSNEI
SKEQGKATLLEDQQDPSPSS
Download sequence
Identical sequences ENSNLEP00000020213 ENSNLEP00000020213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]