SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020263 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020263
Domain Number 1 Region: 377-543,624-738
Classification Level Classification E-value
Superfamily L domain-like 3.18e-49
Family Ngr ectodomain-like 0.00097
Further Details:      
 
Domain Number 2 Region: 140-346
Classification Level Classification E-value
Superfamily L domain-like 1.91e-41
Family Ngr ectodomain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 1012-1201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-41
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 1-109
Classification Level Classification E-value
Superfamily L domain-like 8.16e-27
Family Ngr ectodomain-like 0.0032
Further Details:      
 
Domain Number 5 Region: 863-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000686
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 783-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000195
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 940-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000372
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 826-870
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 905-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000545
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 1197-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000958
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1277-1317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000315
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020263   Gene: ENSNLEG00000016689   Transcript: ENSNLET00000021276
Sequence length 1395
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:12591615:12760355:1 gene:ENSNLEG00000016689 transcript:ENSNLET00000021276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSV
ASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQK
REFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTI
KVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLF
SLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPF
ICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDY
RSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTVLEATG
IFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLM
LRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYL
AWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECA
CLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTL
SNQSFSNMTQLLTLILSYNRLRCIPHRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALS
HLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTCQGPVD
VNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTC
HLKEGEEDGFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGEL
CEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCT
DAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIVRINEPICQCLPGYQ
GEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKDHIAVELYR
GRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQST
LNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQTGILPG
CEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKVPAAYTDIQLFIH
SCLKCLNXXXGVLCDEEEDLNPCQAIKCKHGKCRSGLGQPYCECSSGYTGDSCDREISCR
GERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYSFECTDGSSFVD
EVEKVVKCGCTRCVS
Download sequence
Identical sequences ENSNLEP00000020263 ENSNLEP00000020263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]