SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020378 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020378
Domain Number 1 Region: 385-683
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-57
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 61-310
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-33
Family WD40-repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020378
Domain Number - Region: 1013-1039
Classification Level Classification E-value
Superfamily Trefoil 0.0733
Family Trefoil 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020378   Gene: ENSNLEG00000016773   Transcript: ENSNLET00000021394
Sequence length 1322
Comment pep:known_by_projection supercontig:Nleu1.0:GL397400.1:1017104:1098230:1 gene:ENSNLEG00000016773 transcript:ENSNLET00000021394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWMTYISNWFEQDDWYEGLQRANMSQVRQVGLLAAGCQPWNKDVCAASGDRFAYCATLA
IYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLFASGSTDNLVIIWNVAEQKVIA
KLDSTKGIPACLSWCWNAENVVAFVSHRGPLFIWTISGPDSGVTVHKDAHSFLSDICIFR
WHTHKKGKVVFGHIDGSLSIFHPGNKNQKHVLRPESLEGTEEEDPVTALEWDPLSTDYLL
VVNLHYGIRLVDSESLSCITTFNLPSAAASVQCLAWVPSAPGMFITGDTQVGVLRIWNVS
RTTPIDNVKLKKTGFHCLHVLNSPPRKKFSVQSPTKNHYTSSTSEAVPPPTLTQNQAFSL
PPGHAVCCFLDGGVGLYDMGAKKWDFLRDLGHVETIFDCKFKPDDPNLLATASFDGTIKV
WDINTLTAVYTSPGNEGVIYSLSWAPGGLNCIAGGTSRNGAFIWNVQKGKIIQRFNEHGT
NGIFCIAWSHKDSKRIATCSSDGFCIIRTIDGKVLHKYKHPAAVFGCDWSQNNKDMIATG
CEDTNVRVYYVATSSDQPLKVFSGHTAKVFHVKWSPLREGILCSGSDDGTVRIWDYTQDA
CINILSGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWDTREGTCVDTVYDHGADVYGLTC
HPSRPFTMASCSRDSTVRLWSLTALVTPVQMNILADRSWEEIIGNTDYAIEPGTPPLLCG
KVTRDIRQEIEKLTANSRVKKLRWFSECLSPPGGSDNLWNLVAVIKGQDDSLLPQNYCKG
IMHLKHLIKFRTSEAQELTTVKMSKFGGGIGVPTKEERLKEAAEIHLRLGQIQRYCELMV
ELGEWDKALSIAPGVSVKYWKKLMQRRADQLIQEDKDDVIPYCIAIGDVKKLVHFFMSRG
QLKEALLVAQAACEGNMQPLHVSVPKGASYSDDIYKEDFNELLHKVSKELAEWYFQDGRA
VLAACCHLAIDNIELAMAYLIRGNELELAVCVGTVLGESAAPATHYALELLARKCMMISV
CFKSFPQSVPFCYVNRNLAADLLLMIPDNELHLIKLCAFYPGCTEEINDLHDKCKLPTVE
ECMQLAETAHADDNIFETVKYYLLSQEPEKALPIGISFVKEYISSSDWTLDTIYPVLDLL
SYIRTEKLLLHTCTEARNELLILCGYIGALLAIRRQYQSIVPALYEYTSQLLKRREVSVP
LKIEYLSKELDAWRACTQSTNRSLEDSPYTPPSDSQRMIYATLLKRLKEESLKGVIGPDY
VTGSNLPSHSDIHISCLTGLKIQGPVFFLEDGKSAISLNDALMWAKVNPFSPLGTGIRLN
PF
Download sequence
Identical sequences ENSNLEP00000020378 ENSNLEP00000020378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]