SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020380 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020380
Domain Number 1 Region: 148-406
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-81
Family Eukaryotic proteases 0.000000000783
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Kringle-like 2.27e-32
Family Kringle modules 0.00000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020380   Gene: ENSNLEG00000016781   Transcript: ENSNLET00000021396
Sequence length 414
Comment pep:known_by_projection supercontig:Nleu1.0:GL397335.1:8174970:8180035:1 gene:ENSNLEG00000016781 transcript:ENSNLET00000021396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFHLRTRYEQANCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHF
YRGKASTDTMGRPCLAWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQV
GLKPLVQECMVHDCTDEKKPSSPPEELQFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIY
RRHRGGSVTYVCGGSLISPCWVVSATHCFIDYPKKEDYIIYLGRSRLNSNTQGEMKFEVE
NLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPHFGTSCEITG
FGKENSTDYLYPEQLKMTVVKLISHKECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSG
GPLVCSIRGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Download sequence
Identical sequences ENSNLEP00000020380 ENSNLEP00000020380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]