SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020402 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020402
Domain Number 1 Region: 9-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-39
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 412-593
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-38
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 3 Region: 599-777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 206-403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.27e-36
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 803-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000438
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020402   Gene: ENSNLEG00000016802   Transcript: ENSNLET00000021418
Sequence length 870
Comment pep:novel supercontig:Nleu1.0:GL397280.1:15836295:16236363:1 gene:ENSNLEG00000016802 transcript:ENSNLET00000021418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPSTHFHWDLGQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHT
GKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVD
GILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLEL
SRLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTE
PNGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKAND
GEWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELW
TAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCK
DGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAY
GLLVATTSRDSADTLRLELDGGRVKLMVNLGKGPETLYAGQKLNDNEWHTVRVVRRGKSL
KLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGLLYIDL
CKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSPDGFI
LFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHS
LKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRL
PDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCNDR
KYNNLSYWNFVKMFGDLENLKGQYVKGWLF
Download sequence
Identical sequences ENSNLEP00000020402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]