SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020484 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020484
Domain Number 1 Region: 423-656
Classification Level Classification E-value
Superfamily HCP-like 2.62e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 630-764
Classification Level Classification E-value
Superfamily HCP-like 1.02e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 263-387
Classification Level Classification E-value
Superfamily HCP-like 5.32e-24
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 181-234
Classification Level Classification E-value
Superfamily Kringle-like 4.57e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020484   Gene: ENSNLEG00000016861   Transcript: ENSNLET00000021501
Sequence length 858
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:18738240:18804319:-1 gene:ENSNLEG00000016861 transcript:ENSNLET00000021501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIGPEARDGGRGLAGRWVRDAWEGAEEGDESRKSSGEAAAAADSVVAAAKATALGIGTG
LERRMRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVA
GQIFLDAEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALT
AIEGTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAK
RRQMQEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLP
QNIQAARGMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMV
LGYRYWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGML
EEDLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFL
GKMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQK
AAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVM
RSCHTAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFI
LDQREATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRL
ASEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVY
FLQYIRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPG
PRPAPPQQEGPPEQQPPQ
Download sequence
Identical sequences ENSNLEP00000020484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]