SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020496 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020496
Domain Number 1 Region: 1971-2194
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.32e-79
Family Fibrinogen C-terminal domain-like 0.00000198
Further Details:      
 
Domain Number 2 Region: 894-1064
Classification Level Classification E-value
Superfamily Fibronectin type III 9.43e-22
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 1801-1965
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-21
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 1708-1797
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-19
Family Fibronectin type III 0.0000207
Further Details:      
 
Domain Number 5 Region: 624-788
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-17
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1260-1344
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000016
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 801-891
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000389
Family Fibronectin type III 0.00000291
Further Details:      
 
Domain Number 8 Region: 1169-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000168
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 9 Region: 1621-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000213
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 10 Region: 1078-1162
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000104
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 11 Region: 1530-1617
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000713
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 12 Region: 1441-1526
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000292
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 13 Region: 1348-1435
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000047
Family Fibronectin type III 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020496
Domain Number - Region: 412-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000445
Family Integrin beta EGF-like domains 0.065
Further Details:      
 
Domain Number - Region: 505-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000773
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 474-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00129
Family EGF-type module 0.093
Further Details:      
 
Domain Number - Region: 536-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.002
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 598-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00282
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 381-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00406
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00509
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 258-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 225-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 194-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 319-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.011
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 348-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0122
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 443-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.02
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 567-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0445
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020496   Gene: ENSNLEG00000016850   Transcript: ENSNLET00000021516
Sequence length 2201
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:8876018:8972831:-1 gene:ENSNLEG00000016850 transcript:ENSNLET00000021516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAMTQLLAGVFLAFLALTTEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGQCIDGQCICDEGFTGEDCSQLACPRDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKLTCPHACHDQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNHGRCVDGQCECDDGFTGADCGELKCPNGCSGRGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGRCVDGQCVCEDGFTGPDCAELSCPNDCHGRG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGHCVDGQCICHEGFTGLDCGQRSCPNDCSN
LGQCVSGRCICNEGYTGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQVEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKALHVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYSVLLTAEKGRHKSKPAHVKASTEQAPELENL
TVTEAGWDGLRLNWTAADQAYEHFVIQVQEANKVEAAQNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGTLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEAEQVEEAHNLTVPGSLRSVEISGLRAGT
PYTITLHSEVRGHSTRPLAVEVTTEELPQLGDLALSQVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTVHGSLRAMDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWTATDGIFEIFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDDFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQPVSTIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGIPSMVTVDGTKTQTRLVKLIPGVEYLVNIIAMKGFEESEPVSGSFTTALD
GPSGLVTSNITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPV
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGNASLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Download sequence
Identical sequences ENSNLEP00000020496 ENSNLEP00000020496 XP_012364578.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]