SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020606 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020606
Domain Number 1 Region: 713-812,971-1137,1206-1267
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.51e-46
Family Quinoprotein alcohol dehydrogenase-like 0.027
Further Details:      
 
Domain Number 2 Region: 11-426
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.67e-44
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number 3 Region: 1572-1646,1698-1843,1901-1969
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.05e-38
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 4 Region: 1394-1557,1606-1774
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.14e-31
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 5 Region: 410-591
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000000068
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.017
Further Details:      
 
Domain Number 6 Region: 868-1026
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000314
Family Soluble quinoprotein glucose dehydrogenase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020606   Gene: ENSNLEG00000016938   Transcript: ENSNLET00000021637
Sequence length 1975
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:25832450:26011770:-1 gene:ENSNLEG00000016938 transcript:ENSNLET00000021637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARSAPSCHLRLEWVYGYRGHQCRNNLYYTAAKEIVYFVAGVGVVYSPREHRQKFYRGH
SDDIISLALHPERVLVATGQVGKEPYICIWDSYTVQTISVLKDVHTHGIACLAFDLDGQR
LVSVGLDSKNAVCVWDWKRGKMLSMAPGHTDRIFDISWDLYQPNKLVSCGVKHIKFWSLC
GNALTPKRGVFGKTGDLQTILCLACARDELTYSGALNGDIYVWKGINLIRTIQGAHAAGI
FSMNACEEGFATGGRDGCIRLWDLTFKPITVIDLRETDQGYKGLSVRSVCWRGDHILVGT
QDSEIFEIVVQERNKPFLIMQGHCEGELWALAVHPTKPLAVTGSDDRSVRIWSLVDHALI
ARCNMEEPIRCAAVNADGIHLALGMKDGSFTVLRVRDMTEVVHIKDRKEAIHELKYSPDG
TYLAVGCNDSSVDIYGVAQRYKKVGECLGSLSFITHLDWSSDGRYLQTNDGNGKRLFYRM
PGGKEVTSTEEIKGVHWASWTCVSGLEVNGIWPKYSDINDINSVDGNYIGQVLVTADDYG
IIKLFRYPCLRKGAKFRKYIGHSAHVTNVRWSHDYQWVISIGGADHSVFQWKFIPERKLK
DALHIAPQESLADSHSDESDSDLSDVPELDSEIEQETQLTYRRQVYKEDLPQLKEQCKEK
QKSATSKRRERAPGNSIRLHFVHGYRGYDCRSNLFYTQIGEIVYHVAAVGVIYNRQQNTQ
RFYLGHDDDILCLTIHPLKDYVATGQVGRDPSIHIWDTETIKPLSILKGHHQYGVSAVDF
SADGKRLASVGIDDSHTIVLWDWKKGEKLSIARGSKDKIFAVKMNPYVPDKLITAGIKHM
KFWRKAGGGLIGRNGYIGTLGKNDTMMCAVYGWTEEMAFSGTSTGDVCIWRDIFLVKTVK
AHDGPVFSMHALEKGFVTGGKDGIVALWDDSFERCLKTYAIKRAALAPGSKGLLLEDNPS
IRAISLGHGHILVGTKNGEILEVDKSGPITLLVQGHMEGEVWGLATHPYLPICATVSDDK
TLRIWDLSPSHCMLAVRKLKKGGRCCCFSPDGKALAVGLNDGSFLMANADTLEDLVSFHH
RKDMISDIRFSPGSGKYLAVASHDSFIDIYNVMSSKRVGICKGATSYITHIDWDIRGKLL
QVNTGAKEQLFFEAPRGKKQTIPSVEVEKIAWASWTSVLGLCCEGIWPVIGEVTDVTASC
LTSDKMVLATGDDLGFVKLFRYPTKGKFGKFKRYVAHSTHVTNVRWTCDDSMLVTLGGTD
MSLMVWTNEMEGYREKRPCDSEESDIDSEEDGGYDSDVTRENEISYTIRALSTNIRPMFG
IKPHLQQKEPSVDERFILCCRPPVSRAPPQPEKLQTNNVGKKKRPIEDLVLELIFGYRGR
DCRNNVHYLNDGDDIIYHTASVGILHNVATGSQSFYQEHNDDILCLTVNQHPKFINIVAT
GQVGDSADMSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHT
ITIWRWQEGAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLL
STLEDARMQTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRD
GLIVTGGKERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRNAE
IIEVGEKNAACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNL
GHAARTVCYSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCAIHDIRFSPDSRYLAV
GSSENSVDFYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRYLQVSSGCYKRHVYEVPSG
KHLMDHAAIDRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVK
LFDFPCPEKFAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCVHTPH
Download sequence
Identical sequences ENSNLEP00000020606 ENSNLEP00000020606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]