SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021201 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021201
Domain Number 1 Region: 164-337
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-34
Family Pentraxin (pentaxin) 0.00076
Further Details:      
 
Domain Number 2 Region: 880-949
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.62e-20
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 3 Region: 1567-1636
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-18
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 4 Region: 1509-1578
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 697-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.06e-17
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 6 Region: 1115-1185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.18e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 581-650
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-17
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 8 Region: 1975-2044
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 1451-1520
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 10 Region: 523-592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-17
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 11 Region: 1232-1301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-17
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 12 Region: 999-1067
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 424-482
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-17
Family Complement control module/SCR domain 0.00061
Further Details:      
 
Domain Number 14 Region: 1290-1357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 1407-1462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 1625-1694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2152-2211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 18 Region: 1799-1866
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000129
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 2034-2099
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000139
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 1174-1243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 21 Region: 1684-1746
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000417
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 938-1009
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000681
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 23 Region: 640-702
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000011
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 24 Region: 367-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000106
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 34-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000116
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 26 Region: 1058-1126
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000639
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 27 Region: 1743-1809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 28 Region: 754-822
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000278
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 1857-1920
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 30 Region: 2093-2161
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 6-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000011
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 32 Region: 1916-1980
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 33 Region: 819-886
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 477-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000345
Family EGF-type module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021201
Domain Number - Region: 2203-2239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 2242-2271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000182
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2271-2302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000265
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021201   Gene: ENSNLEG00000017463   Transcript: ENSNLET00000022276
Sequence length 2307
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:18204695:18292086:-1 gene:ENSNLEG00000017463 transcript:ENSNLET00000022276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAGQRCEENINECSSSPCLNKGICVDGVAGYHCTCVKGFVGLHCETEVNECQSNPCLNNA
VCEDQVGGFLCKCPPGFLGTRCGKNVDECLSQPCKNGATCKDGANSFRCLCAAGFTGSHC
ELNINECQSNPCRNQATCVDELNSYSCKCQPGFSGKRCETEQSTGFNLDFEVSGIYGYVM
LDGVLPSLHALTCTFWMKSSDDMNYGTPISYAIDNGSDNTLLLTDYNGWVLYVNGREKIT
NCPSVNDGRWHHIAITWTSANGIWKVYIDGKLSDGGAGLSIGLPIPGGGALVLGQEQDKK
GEGFSPAESFVGSISQLNLWDYVLSPQQVNSIFSVTVMRCKGTNLVKISWLSEFITTLHL
CSLPSDCPRLGGSVPHLRTASEDLKPGSKINLFCDPGFQLVGNPVQYCLNQGQWTQPLPH
CERISCGVPPPLENGFHSADDFYAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGVSPSCL
DVDECAVGSDCSEHASCLNTDGSYLCSCIPPYTGDGKNCAEPIKCKAPGNPENGHSSGEI
YTAGAEVTFSCQEGYQLMGVTKITCLESGEWNHLIPYCKAVSCGKPAIPENGCIEELAFT
FGSKVTYRCNKGYNLAGDKESSCLANGSWSHSPPVCEPVKCSSPENINNGKYILSGLTYL
STASYSCDTGYSLQGPSIIECMASGIWDRAPPACHLVFCGEPPAIKDAVIMGSNFTFRNT
VTYTCKEGYTLAGPDTIECLADGKWSRSDQQCLAVSCDEPPNVDHASPETAHRLFGDIAF
YYCSDGYSLADNSQLLCNAQGKWVPPEGQDMPRCIAHFCEKPPSVSYSILESVSKAKFAA
GSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPMSIQCIPVRCGEPPSIMNGYASGSNYSF
GAMVAYSCNKGFYIKGEKKSTCEATGQWSNPIPTCHPVSCGEPPKVENGFLEHTTGRIFE
SEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLMCVPLDCGKPPLIQNGFMKGENFEVGS
KVQFFCNEGYELVGDSSWTCQKSGKWNMKSNPKCVPAKCPEPPLLENQLVLKELTTEVGV
VTFSCKEGHVLQGPSVLKCLPSQQWNDSFPVCKMVLCTPPPLISFGVPVPSSALHFGSTV
KYSCVGGFFLRGNSTTLCQPDGTWSSPLPECVPVECPQPEEIPNGIIDVQGLAYLSTALY
TCKPGFELVGNTTTLCGENGHWLGGKPTCKAIECLKPKEILNGKFSYTDLHYGQTVTYSC
NRGFRLEGPSALTCLETGDWDVDAPSCNAIHCDSPQPIENGFVEGADYSYGAIIIYSCFP
GFQVAGHAMQTCEESGWSSSIPTCVPIDCGLPPHIDFGDCTKVKDDHGYFEQEDDMMEVP
YLTPHPPYHLGAVAKTWENTKESPATHSSNFLYGTMVSYTCNPGYELLGNPVLICQEDGT
WNGSAPSCISIECDLPTAPENGFLRFTETSMGSAVQYSCKPGHILVGSDLRLCLQNRKWS
GASPHCEAISCKKPNPITNGSIKGSNYTYLSTLYYECDPGYVLNGTERRTCQDDKNWDED
EPICIPVDCGSPPVSANGQVRGDEYTFQKEIEYTCNEGFLLEGARSRVCLANGSWSGATP
DCVPVRCATPPQLANGVMEGLDYGFMKEVAFHCHEGYILHGAPKLTCQSDGSWDAEVPLC
KPVNCGPPEDLAHGFPNGFSFIHGGHIQYQCFPGYKLHGNSSRRCLSNGSWSGSSPSCLP
CRCSTPVIEYGSVNGTDFDCGKAAQIQCFQGFKLLGLSEITCEANGQWSSGFPHCEHTSC
GSLPMIPNAFISESSSWKENVITYSCRSGYVIQGSSDLICTEKGVWSQPYPVCEPLSCGS
PPSVANAVATGEAHTYESEVKVRCLEGYTMDTDTDTFTCQKDGRWFPERISCSPKKCPFP
ENITHILVHGDDFSVNRQVSVSCAEGYTFEGVNISVCQLDGTWEPPLSDESCSPVSCGKP
ESPEHGFVVGSKYTFESTIIYQCEPGYELEGNRERVCQGNREWSGGVAICKETRCEAPLE
FLNGKADIENTTTGPNVVYSCNRGYSLEGPSEAHCTENGTWSHPVPLCKPNPCPVPFVIP
ENALLSEKEFYVDQNVSIKCREGFLLQGHGIITCNPDETWTQTSAKCEKISCGPPAHVEN
AIVRGIHYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTSPPICRAVCRFPCQNGGICQR
PNACSCPEGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQSPCLNGG
KCVRPNRCHCLSSWTGHNCSRKRRTGF
Download sequence
Identical sequences ENSNLEP00000021201 ENSNLEP00000021201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]