SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021319 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021319
Domain Number 1 Region: 176-415
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 3.53e-75
Family Oxidoreductase molybdopterin-binding domain 0.0000000159
Further Details:      
 
Domain Number 2 Region: 418-539
Classification Level Classification E-value
Superfamily E set domains 3.71e-39
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.00000552
Further Details:      
 
Domain Number 3 Region: 83-161
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.83e-19
Family Cytochrome b5 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021319   Gene: ENSNLEG00000017568   Transcript: ENSNLET00000022400
Sequence length 541
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:56810841:56818303:-1 gene:ENSNLEG00000017568 transcript:ENSNLET00000022400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLHKAVVLRLQQACRLKSIPSRICIQACSTNDSFQPRRPSLTFSGDNSSTQGWRVMGT
LLGLGAVLAYQDRRCRXXQESTHIYTKEEVSSHTSPETGIWVTLGSEVFDVTEFVDLHPG
GPSKLMLAAGGPLEPFWALYGVHNQSHVRELLAQYKIGEVNLRKVTPTMRHLSLADDPVR
HPAMKVNSQRPFNAEPPLSADRNYITPNPIFFTRNHLPVPNLDPDYRLHVVGAPGGQSLS
LSLDDLHNFPKYEITVTLQCAGNRRSEMTQVKEVKGLEWRTGAISTARWAGARLCDVLAQ
AGHQLCETEAHVCFEGLDADPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRDHGFP
VRVVVPGVVGARHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWDTVDFDSAPSIQELP
VQSAITEPRDGETVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRK
AWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYVS
P
Download sequence
Identical sequences ENSNLEP00000021319 ENSNLEP00000021319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]