SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021639 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021639
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily Aquaporin-like 1.83e-68
Family Aquaporin-like 0.0000000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021639   Gene: ENSNLEG00000017815   Transcript: ENSNLET00000022731
Sequence length 271
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:62592656:62600767:-1 gene:ENSNLEG00000017815 transcript:ENSNLET00000022731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWELRSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALG
HISGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNA
LSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTG
CSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGL
EPDTDWEEREVRRRQSVELHSPQSLPRGTKA
Download sequence
Identical sequences A0A2I3S3K4 G1S800
XP_003252218.1.23891 XP_003825902.1.60992 XP_016778931.1.37143 ENSNLEP00000021639 ENSNLEP00000021639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]