SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021654 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021654
Domain Number 1 Region: 195-356,416-478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 481-665
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.4e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 15-77
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000154
Family Flavin-binding PAS domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021654   Gene: ENSNLEG00000017827   Transcript: ENSNLET00000022746
Sequence length 1054
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:62984829:63002219:-1 gene:ENSNLEG00000017827 transcript:ENSNLET00000022746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQRGCACSFLYGPDTSELVRQQIRKA
LDEHKEFKAELILYRKSALPSVKLDCQPFPQETARCCLCPARDVSSAENGRGPDRWKETG
GGRRRYGRARSKGFNANRRRSRAVLYHLSGHLQKQPKGKHKLNKGVFGEKPNLPEYKVAA
IRKSPFILLHCGALRATWDGFILLATLYVAVTVPYSVCVSTAREPSAARGPPSVCDLAVE
VLFILDIVLNFRTTFVSKSGQVVFAPKSICLHYVTTWFLLDVIAALPFDLLHAFKVNVYF
GAHLLKTVRLLRLLRLLPRLDRYSQYSAVVLTLLMAVFALLAHWVACVWFYIGQLEIESS
ESELPEIGWLQELARRLETPYYLVGRRPAGGNSSGQSDNCSSSSEANGTGLELLGGPSLR
SAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYA
RRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNNGIDTTELLQSLPDELRADI
AMHLHKEVLQLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEV
LKGGTVLAILGKGDLIGCELPRREQVVKANADVKGLTYCVLQCLQLAGLHDSLALYPEFA
PRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEP
SSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGVLKAEAGPSAPPRALEGLRL
PPMPWNVPPDLSPRVVDGIEDGCGSDQPKFSFRVGQSGPECSSSPSPVPESGLLTVPRGP
SEARSTDTLDKLRQAVTELSEQVQQMREGLQSLRQAVQLVLASHREGPCPRASGEGPCPA
STSGLLQPLCVDTGASSYCLQPPAGSVLSGTWPHPRPGPPPLMAPWPWGPPASQSSPWPR
APAFWTSTSDSEPPASGDLCSEPSTPASPPPSEEGARTGPPEPVSQAEATSTGEPPPGSG
GLALPWDPHSLEMVLIGCHGSGTVQWTQEEGTGV
Download sequence
Identical sequences ENSNLEP00000021654 ENSNLEP00000021654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]